PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_024944-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family HB-other
Protein Properties Length: 1674aa    MW: 187572 Da    PI: 5.1736
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_024944-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox55.11.2e-172781357
                   --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
       Homeobox  3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
                   kR   t++qle Le+ ++ + yps++ r+eL++klgLt+rq ++WF+ rR k++k
  NNU_024944-RA 27 KRKMKTASQLELLEKTYAVETYPSESLRAELSAKLGLTDRQLQMWFCHRRLKDRK 81
                   89999************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.0E-17581IPR009057Homeodomain-like
SuperFamilySSF466891.54E-151681IPR009057Homeodomain-like
PROSITE profilePS5007116.522282IPR001356Homeobox domain
SMARTSM003892.9E-162486IPR001356Homeobox domain
CDDcd000863.95E-132581No hitNo description
PfamPF000463.0E-152781IPR001356Homeobox domain
SMARTSM005712.4E-23586645IPR018501DDT domain
PROSITE profilePS5082717.61586645IPR018501DDT domain
PfamPF027911.3E-17587642IPR018501DDT domain
PfamPF050666.6E-14768833IPR007759HB1/Asxl, restriction endonuclease HTH domain
PfamPF156121.7E-8900943IPR028942WHIM1 domain
PfamPF156135.4E-1210771144IPR028941WHIM2 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1674 aa     Download sequence    Send to blast
MEAGSEGEKK KPPEGGGSGG GGEQKVKRKM KTASQLELLE KTYAVETYPS ESLRAELSAK  60
LGLTDRQLQM WFCHRRLKDR KVAPVKRQRK DAPVSGGVGD EMMVGGELGN EPGSGSGSGS  120
SPFGQGEPRK VVARASSAVP RIGADMPMMK RYYEPPQSIT ELRAIAFVEA QLGEPLREDG  180
PILGMEFDPL PPDAFGAPLA VMGQQKQGGR LYDGNVYERH DAKSIKTSSL LPNMEHCFVP  240
SSSSGKRKSA TGVHVVHPQT APRTVQEYQF LPEQPTVRSD AYERVAPSHF YDSPIDGPSS  300
RTSSLSAVGT FLHGNEQMGI GYGFHGQVPG VGHLPQQVRQ GHVFSSGSGE YENVPHRNSY  360
TNIGMDAQFA SHPIGLENPF VPSDRRVFHE DDVSRMERKR KSDEARIARE VEAHEKRIRK  420
ELEKQDMLRR KREEQMRKEM ERHDRERRKE EERLMRERQR EEERFQREQR RENERREKFL  480
QKETLRAEKL RQKEELRREK EAARIKAANE RATARRLAKE SMELIEDERL ELMELAASTK  540
GLPSMISLDG ETLQNLESFR DMLSTFPPKS VKLKKPFSVQ PWTDSNENIG NLLMVWRFLI  600
TFADVLGLWP FTLDEFVQAF HDYDPRLLGE IHVSLLRSII KDIEDVARTP SIGLGANQNS  660
AANPGGGHPQ IVEGAYAWGF DIRTWQRHLS PLTWPEILRQ FALSAGFGPQ LKKRSIGRAY  720
FRDDNEGHDG EDIVSILRTG TAAENAVALM QEKGFSHPRR SRHRLTPGTV KFAAFHVLSL  780
EGSKGLTILE VADKIQKSGL RDLTTSKTPE ASIAAALSRD SALFERTAPS TYCGISGNEV  840
GETPPHNFPN SGKSFSPFFS EGTKEVISSG ATFDQSVDVA RNCNDTSNPD QEDTEIDESN  900
SGEPWVQGIM EGEYSDLSVE ERLNALVALI GVAIEGNSIR IVLEERLEAA NALKKQMWAE  960
AQLDKRRMKE EYVTKLQYSS YKAENNLISP AIEGSQSPLP GVDNKNNEAS LNPFKQEPFL  1020
DPQNGQSNMP AERNLAGQEI TVQDNFPLQQ HSYATEKSRR QLKSSIGHRA EEMYVYRSLP  1080
LGQDRRRNRY WQFVASASKN DPGSGRIFFE SHDGCWRLID SEEVFDALLA SLDTRGIRES  1140
HLHSMNKSEK NDALKRYEDF QKWMWKECFT PTTLCAMKYG KKRCQQLLGT CVSCQNLYFF  1200
EDNHCPSCHR TFSNFSNNLN FNFSEHVIQC EETQKVDPDW NSCDLDSSLP LRTRLLKAML  1260
ALIEVSVPPE ALQSFWTKSY RKYWGVKLHS SSSAEELLQL LTMLEGAIKR DCLSSNFETT  1320
KELLGSSTTS GSNTDDFPPP ESIAVLSWVP LTTAAVALRL MELDASISYM LHQKVEFSKD  1380
KEAGEFIKLP SRYTVVKNFP EIEPAEAADQ GKYMQEESWI DPGSGRNSSG RGRGVRGRGR  1440
GRSRGGRWQR RGTVSRSEPG NSVKIGQGLE RKGRTRGRGR RRGRRTVRSR QRLQKRVVEE  1500
TVLHHFNNID SPKQDSGGQS PRSSVGGDWD IEETRRMHHF EGAENSNSAE ASSESDDNCQ  1560
GTGDEYDDQG ADYAGVFNGK SEDLMEGSDE DVEGDDDGDG EEADVDADGD GDDRDEEEDG  1620
DMDEVDEMDG EVEGDEEGDM DDGELDGVGN EDEDGEGNGD EDQGIGSTSS EYSD
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
114731483RTRGRGRRRGR
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010245586.10.0PREDICTED: uncharacterized protein LOC104589094 isoform X1
SwissprotQ9FFH10.0RLT2_ARATH; Homeobox-DDT domain protein RLT2
TrEMBLA0A061E4G40.0A0A061E4G4_THECC; Homeodomain-like transcriptional regulator, putative isoform 1
STRINGPOPTR_0011s05660.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G44180.20.0Homeodomain-like transcriptional regulator